KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0657Help
Entry
FTH_0657          CDS       T00399                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
640922..641671
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPHNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTHCHKFETYLRVFIDLYELLDTYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
NRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcataatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcggtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatcgatttgtttaaaaataaaaagatctatagtgtcggtgccagt
actgctgctatattagaaaaataccaattagctgcaatatatccagttagacatggctca
caagaacttttagatatcatattaaatcaagatatttctaaagaaaaatttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaaattaacacactgtcat
aaatttgagacgtatttacgagtttttatagatctttatgagttgttagatacttataat
aaactttttttacataatcagccggatattataattgctacaagtcttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
aatagaaaaaaacacccagcaacaaagtag

DBGET integrated database retrieval system