KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0673Help
Entry
FTH_0673          CDS       T00399                                 

Gene name
recD
Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTH_0673 (recD)
Enzymes [BR:fth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTH_0673 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660963..662831
Genome map
AA seq 622 aa AA seqDB search
MLVYLMEMIMYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTPSMTTLSSESYPPFHGA
KGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPS
SDKIASILDNLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEV
VDKLFEPAGEINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIAL
LAPTGKAAQRMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQT
IHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTN
QLPSVEAGSLLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNEN
IKFHSLRNLDIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIE
KFMSKPIDSNYKGKPIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNML
PKYESVYAMTIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLR
DIAQKDIKRNSNISELVSLSTQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtttatttaatggagatgataatgtataaaactttccataaagcttgtgagcaa
ttagcagatattagagccatagattttttctttgctaaagaggtgtttgatttagtcaaa
aagactactccgtctatgaccactttatcaagtgagtcatatccaccctttcacggagca
aaggggaatgatttggaacaaaaaagtaatgaaattttatttcatattttgatgaagctt
atgcatgtgtatagtcatggtcatagctgtttgaagatagcagatatatcaaataaaact
atttttgcttcagagcaaagtaatcagagtgatgctaaagtaggctttaaaatgccaagc
tctgataaaattgcaagtattttagataacttaaattacgataatttacctatatatttt
gccaaacagtatgattctttgtatattaaaagattgtggaattatgagaatgaaatagct
aactttataaaattaaaaacaatccaaaatactcaaaaagacaatcgtattgaagaagtt
gtagacaaactatttgaacctgctggtgaaatcaactggcaaaaacaggcggttatcaaa
agtctaaattataattttagtattatctcaggtggacctggtacaggtaagacaactaca
gtcgcaaagcttttacttgctatacaaatgcttaatcaaaatcagcaaagaatagcgctt
ttagcaccaactggtaaggctgctcagagaatgacagagtcattaaaaaatactctagca
actgtcattccgtcaagcttgaccacagaatctactatacaaaaaaatgatatctttaaa
caagttcaggatgaacttaatagtgttgctcagtatcttaataatctagaagcacaaact
atacatagatttttaggcttaagaccaaactctacttatgttaaatataaccaacaatct
aaagctccattcgatgttattattgttgatgaagcttcgatgcttgatatgaatattttt
atcaagttaattagagctgtagcagataatactaagttgatattaataggtgatactaat
cagttaccatctgttgaggctgggagtcttttagcaaactttacacatgataaatatggt
agcattacgccatatacaacattacttatcaaaaactatcgttcacaacaatatataaat
aatcttgcagcctcagtcctaaaaggcgatgttaatattgatagtcaacaaaatgaaaat
attaaatttcatagtctaagaaatttagatatttatttaagagagtatgcaaagagatat
tcacagcttgaaaagtgccgtgactacaaagaggctcttacagagctgaataaatttaga
atacttgtggctaacaaaaacctagaaattggtacagataagttaaatcagaaaattgag
aagtttatgtctaagcctatagattctaactataagggtaaaccaattatgataactcaa
aatagttattcattagggttatttaatggagatgtagggattatgtggcctgatgatact
ggtaagctccgagcatattttgatggtaaagatgctaaggcatttagtctaaatatgcta
ccaaaatatgaaagtgtttatgcgatgacaattcataaaactcaaggctcagagtttgat
gaaatcgtgattattcttccagcagaagataatgaagcgctaagtaaacaacttttgtat
acagctattactagagcaaaatataaattaacgattatatctgaacaaagtagcttaaga
gatattgctcagaaagatattaagagaaattcaaatatcagtgaattagttagcttgagc
actcaataa

DBGET integrated database retrieval system