KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0911Help
Entry
FTH_0911          CDS       T00399                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTH_0911 (ruvA)
Enzymes [BR:fth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FTH_0911 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907821..908471
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTAAEVIRKALQGSIKSKG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaaact
gctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatttat
gctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcaccaaca
tctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagca
gcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaggataa

DBGET integrated database retrieval system