KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1250Help
Entry
FTH_1250          CDS       T00399                                 

Definition
(GenBank) possible transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00010  Glycolysis / Gluconeogenesis
fth00052  Galactose metabolism
fth00500  Starch and sucrose metabolism
fth00520  Amino sugar and nucleotide sugar metabolism
fth00521  Streptomycin biosynthesis
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01120  Microbial metabolism in diverse environments
fth01130  Biosynthesis of antibiotics
fth01200  Carbon metabolism
Module
fth_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTH_1250
   00052 Galactose metabolism
    FTH_1250
   00500 Starch and sucrose metabolism
    FTH_1250
   00520 Amino sugar and nucleotide sugar metabolism
    FTH_1250
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTH_1250
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTH_1250
Enzymes [BR:fth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTH_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF960 IF2_N ATLF
Motif
Other DBs
NCBI-ProteinID: ABI83104
Position
complement(1220735..1221619)
Genome map
AA seq 294 aa AA seqDB search
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIA
KVFTSEVEGIGVGISSVADREKGIVYDVQNIKSWQDIHLKEILEAEFKVPVFIDNDANCF
AIGQRLYGKGKQYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGVEGVEILKRARNNDKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAWSI
ISAREFFEKAMWDEIKTFAFTQSAKKIKIEWSETEGDFQVFSAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcaaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgctggtagggtatgtggagaaaatctattagactcttacttgagcaaaatt
ccaccagatgcagaacataatgctcaatctgttattgatgttgtcataaatactatagca
aaagttttcacctctgaagtagaaggtattggcgttgggatttctagtgttgcagatcga
gaaaagggaattgtatatgatgtgcaaaatatcaaatcatggcaagatattcatctaaag
gaaatactagaggcagaatttaaagtaccagtttttatagataatgatgcaaactgtttt
gctattggacaaagactatatggtaaaggcaaacaatatgaaaattttgttggtattaca
ataggtactggtattggtggaggaattataaataaaggctccttactaaaagactctaat
tgcggtgctggagaatttggcatgttgccatatctagatggaattttagaagattattgt
agtggtcaattttttataaaaaagattggtgttgaaggtgttgagattctcaagcgtgca
agaaataatgataaagatgctataaatatctataaacaatttggtaaacatcttggagta
gcaataaagtctattatgtatactctagacccagaagtgataataatcgcatggtcaata
atatcagccagagagttttttgaaaaagcaatgtgggatgagattaaaacatttgccttt
actcaatcagctaaaaaaattaaaatagaatggtcagaaacggagggagattttcaggtt
tttagcgctgcagctgtttatttggatagaagtagcaatttataa

DBGET integrated database retrieval system