KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1254Help
Entry
FTH_1254          CDS       T00399                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTH_1254
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    FTH_1254
Enzymes [BR:fth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FTH_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1224750..1226417
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVIDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFANAVDNVYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDQTNYTKTSLKINIQTTLEN
IFGNKEIKGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaattaattatgatggattttcgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtactagtggt
tgcggtaatatggcactagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctgtggat
gttaactctaacaaaaataatcctattattggtgtaagatcatactcagataatcctgat
atagttattgactacgccaaaaatgctataaatggttatcatgatgcaaaaattatagac
tgcattaaacatttccctggtcatggtgatactgcaacagatagtcatttaggcaatgta
aacttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgtaccagccctagatgacacc
cagtatcaatcagtttcaacaagtgagaatatttatgtgccagccaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaaggatataatcaaaattctaattttgct
aatgcagttgataatgtctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtattagacaat
aactcaaatgttattattaactgcgaaaatattaataaccataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcaacttctatg
gatcagacaaactatacaaagacttcactaaagattaatattcaaacaacattagaaaat
atttttggtaataaagagattaaaggagtactaccagtcagtttataa

DBGET integrated database retrieval system