KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1353Help
Entry
FTH_1353          CDS       T00399                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00230  Purine metabolism
fth01100  Metabolic pathways
Module
fth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTH_1353 (gmk)
Enzymes [BR:fth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FTH_1353 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_23 AAA_33 AAA_22 MMR_HSR1 AAA_16 AAA_18 RsgA_GTPase AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABI83180
UniProt: Q0BL54
Position
complement(1324384..1324956)
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIISAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEINWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQVQSEISHADEYDYLLVNDDFSQSLEQL
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttataatttctgcaccatctggcgcgggtaaaagttctttatta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattaactggcaaggtgcacaacaaacacgcgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagtacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaatta
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system