KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1353Help
Entry
FTH_1353          CDS       T00399                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fth00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324384..1324956)
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIISAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEINWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQVQSEISHADEYDYLLVNDDFSQSLEQL
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttataatttctgcaccatctggcgcgggtaaaagttctttatta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattaactggcaaggtgcacaacaaacacgcgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagtacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaatta
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system