KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1375Help
Entry
FTH_1375          CDS       T00399                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fth03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1343757..1344359
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNTRTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagataaatcacct
gaaacagcaatagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcata
ggtccaagtgaattaaagctagatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgccaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttggatcaacaaactttactacatgcttttaatacaagaactaatatt
taa

DBGET integrated database retrieval system