KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1375Help
Entry
FTH_1375          CDS       T00399                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTH_1375 (recR)
DNA repair and recombination proteins [BR:fth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     FTH_1375 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FTH_1375 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ABI83199
UniProt: Q0BL35
Position
1343757..1344359
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNTRTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagataaatcacct
gaaacagcaatagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcata
ggtccaagtgaattaaagctagatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgccaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttggatcaacaaactttactacatgcttttaatacaagaactaatatt
taa

DBGET integrated database retrieval system