KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1723Help
Entry
FTH_1723          CDS       T00399                                 

Gene name
sdhD
Definition
succinate dehydrogenase (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:fth01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fth00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fth00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:fth00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1719831..1720199)
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMVYLAMFFHAWVGIWIICGDYIKFAWAFALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggtgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttttgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system