KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1875Help
Entry
FTH_1875          CDS       T00399                                 

Gene name
trpC_trpF
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01130  Biosynthesis of antibiotics
fth01230  Biosynthesis of amino acids
Module
fth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTH_1875 (trpC_trpF)
Enzymes [BR:fth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FTH_1875 (trpC_trpF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     FTH_1875 (trpC_trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABI83613
Position
complement(1885923..1887284)
Genome map
AA seq 453 aa AA seqDB search
METILEKIVEAKRKWLFAKKRLFPLDVFKKEVVKTDRDFYQALESDKAVFILECKKGSPS
KGIIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDE
YQIFLARHYQADAVLLMLSVLDDSEYKKLAKVANRLGMGILTEVSNEEELVRAISLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKRTIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
GERNLELAVRKLVYGFNKVCGLTSVEDAQKAYDAGAVYGGLIFVEKSPRYVDFAMAKQIV
KKVRLNYVGVFADAKIEDVVDTCYALKLSAVQLHGDENQEYIDTLKSKLHRNCQIWKAYP
VDKTLPSFFANVDYHLLDAQVDGKSGGTGKTFDWSLIKDRKNIILAGGLNAKNIAKAIEL
KCSAYDINSGVESEPGQKDQIKLNEVFEIIRSY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattttagaaaaaatcgttgaagcaaaaagaaagtggctttttgcaaaaaaa
agactatttccactagatgtatttaaaaaagaagttgtcaaaacagatagagatttctat
caagctttggaatctgataaagctgtatttattttagaatgtaaaaaaggctctccttct
aaaggaattattcgtaaaaagtttgatctaaatgaaattgcagctgtatacaaaaattat
gcaaatgtgatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaacacaacctatgctttgtaaagattttataatagatgaa
tatcaaatattcttagctaggcattatcaagctgatgctgtgttacttatgctttcagta
cttgatgatagtgagtataaaaaattagcaaaagttgctaatcgtctaggtatgggtata
ttaaccgaagttagtaacgaagaagagcttgtaagagctataagcttaaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatttaaatactacgcgtctt
ttagctccgaaaatacctaaaagaacaattattatttcagaatcagggatctataaaaat
caagaaatacgtgatctaagaaattatgtaaatggctttttgataggaagttctattatg
ggtgaacgtaaccttgaacttgcagttagaaagcttgtttatggttttaataaggtttgc
ggccttacttctgttgaggatgctcaaaaagcatatgatgcaggagcagtctatggtggt
ttgatttttgttgagaagtctcctcgttatgtagattttgccatggcaaaacagatagta
aaaaaagttaggctaaattatgtaggtgtttttgctgacgctaaaatagaagatgttgta
gatacctgctatgcattaaaattaagtgctgtgcagttgcatggtgatgaaaatcaagag
tatatagatactctaaaatcaaagctacatagaaactgtcaaatatggaaagcatatcca
gtagataagactcttccaagtttttttgctaacgtagattatcatttattagatgcccaa
gtagatggtaaatcaggtggtacaggaaaaacatttgattggagtcttatcaaagacaga
aaaaatataattcttgctggcggtctgaatgctaaaaatatagcaaaagcaatagaattg
aagtgttcagcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcaa
atcaaactaaatgaagtatttgaaataattagaagttattaa

DBGET integrated database retrieval system