KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0144Help
Entry
FTS_0144          CDS       T02350                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fti00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157675..158502
Genome map
AA seq 275 aa AA seqDB search
MANIKAKKYYSYAKINLFLHILNKRTDGYHNLQTWFTFLDLKDQLTFSFNNSREINISSN
ISIAAKQDNLVYKAIKKFQQSYRVQDIGVDIEIKKNIPMGAGLGGGSSNAATTLIALRDY
YLPQLSNEEMIPLAVKLGADVPIFVYGKSAWAEGIGEILYHKDFSPQYALLIKPDIHIST
KEFFTSEDLIKSSVLISKDLGFDKSIMHNDFENVFYAKYPEFSQYLKELDSDFRMTGTGS
CFYLLSADKNKLEQLTRKINKPLDKWLVKTLNYVY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaagctaaaaaatactatagttatgcaaagataaatctatttttgcat
atattaaacaaacgtacagatggttaccataatttacagacttggtttacctttttggac
ttaaaagatcaactaacttttagttttaataattcacgagaaattaatatttcgagtaat
attagtattgctgcaaaacaagataatttagtatataaggctatcaaaaaatttcagcaa
agctatagagtgcaagatataggtgttgatattgaaattaagaaaaatattccaatggga
gcaggacttggcggtggaagctcaaatgctgctactacacttatagctttacgtgattat
tatttgccgcagttgtcaaatgaggagatgattccattagcggtaaaacttggtgccgat
gtgccgatatttgtttatggtaaatctgcgtgggcagaaggtataggtgagatattatac
cataaggattttagtccgcagtatgcgctattgattaaaccggatatccatattagtaca
aaagagttttttacaagtgaggatttaattaagtcatcggttctaatatctaaagattta
ggctttgataagagcattatgcataacgattttgagaatgttttttatgcaaaatatcca
gagtttagtcaatatctaaaagagttagatagtgattttagaatgacaggtacaggttct
tgtttttatttactctcagcagataaaaataaacttgagcaacttacaagaaaaattaat
aaacctcttgacaaatggctagtcaaaacattaaactatgtctactaa

DBGET integrated database retrieval system