KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0395Help
Entry
FTS_0395          CDS       T02350                                 

Gene name
glk
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTS_0395 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTS_0395 (glk)
   00052 Galactose metabolism
    FTS_0395 (glk)
   00500 Starch and sucrose metabolism
    FTS_0395 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    FTS_0395 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTS_0395 (glk)
   00524 Butirosin and neomycin biosynthesis
    FTS_0395 (glk)
Enzymes [BR:fti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTS_0395 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(373017..374033)
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNVMKDFPVHIIMNTDVGLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatatcattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtcttgcagtagctggatttgtctctaatggtgaagttgaagtgactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaagaaggtaaaaaagatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgacgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcgttatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagaaccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacgtgatgaaagattttccagtgcatataattatg
aacacagatgtcggtttaataggcgcgcgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system