KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0490Help
Entry
FTS_0490          CDS       T02350                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FTS_0490 (malQ)
Enzymes [BR:fti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FTS_0490 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474770..476233
Genome map
AA seq 487 aa AA seqDB search
MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVLPLTTLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFKDNYLEEAFSNFQSSKD
KFEQEYNDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKNWVKEKAIELDQFQQEID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEVFLLDEDQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKFKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPASEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRDEVFELRDHYNLKGMKV
FPFHFDLKTARLIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGAPNWEWKLVDFNLLKSKTNRLAKQ
VSKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagctggattattattagctatttcaagtttacctagctggtttggcattggt
gatttgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctagtattagaatt
tggcaggttttacctcttacaacactaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgcaaactctaaaaaagttgaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcatttagtaatttccaaagctcaaaagat
aagtttgaacaagagtataatgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggaatttttggcctgcagaa
tataaaaactgggtcaaagagaaagctatagaacttgatcaatttcaacaagagatagat
tatcaaatatttttacagtttatattttataagcagtggtttgagctaagagagtatgct
aataaaaataatattgaaattatgggtgatttgcctatttatctaggttttgattctgct
gatgtgtgggagcatcaagaagtatttttattagatgaggatcaaaatcctagctttgtt
gcaggagttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataaattcaaagaaacaaattttgatttttggatagatcgactaaatggtaat
ttcaagctatttgatattgttaggattgaccattttagagcttttgatacatattggaag
ataccagccagtgaaaaaactgctataaatggtgagtgggtagaagctcctggctatgat
ttctttgatacagtctataagcgtattccagatgctaatattattgcggaagatttagga
gatttgcgagatgaagtatttgagctacgtgatcactataatttaaagggtatgaaagta
ttcccatttcattttgatctaaaaacagctagattgattgatgatgctaatatcatagct
tattcaggtactcacgataataatactttgaaaggttggtattttgacgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtactgtaggtgcgccaaactgg
gagtggaagttggttgattttaatttacttaagtcaaaaactaatcgcttagctaaacag
gtatctaagtctataaatcattaa

DBGET integrated database retrieval system