KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0499Help
Entry
FTS_0499          CDS       T02350                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTS_0499 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTS_0499 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTS_0499 (thrC)
Enzymes [BR:fti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTS_0499 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484740..486032
Genome map
AA seq 430 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLALDGGLFVPERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EVEGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLSQSTYYAYTSWQHYLQTGEK
ANYIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANA
MDVGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFV
AKNQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDEL
CEVYTKAFEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcttgatggaggattatttgtcccagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaagttgaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacacct
tggtggacagagaggactaagttaaatacatcaaatagtattaatatcggtagattacta
tcacaatcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaa
gcaaactatatagttccatctggcaatattggtaatataactgctgctttttgggcaaag
caaatgggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgtt
gactatctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgct
atggatgttggtaaccctagtaattttgaaagattgttatacttgttgggtaattatgaa
aatttcaaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaata
aaacaagtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgta
gcaaaaaatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgct
aagtttgaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgtta
caaaagctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctg
tgcgaggtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system