KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0915Help
Entry
FTS_0915          CDS       T02350                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fti03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
906133..906783
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTAAEVIRKALQGSIKSKG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaaact
gctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatttat
gctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcaccaaca
tctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagca
gcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaggataa

DBGET integrated database retrieval system