KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1227Help
Entry
FTS_1227          CDS       T02350                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fti00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200221..1200841
Genome map
AA seq 206 aa AA seqDB search
MMMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFE
KTPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGT
AEVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKH
ACVSLRGVNNQNSQTYTQMVGGVFAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgaaagataaatattgctctaaattaggtaaaagtgtccaagaacatctcatc
aagttaggtttagagcaacctagagaatttaaccttgataatgataataaaataaccata
atcaccaaagcataccgacaaatcttagatgctctcggcttatacacagatgaatttgaa
aaaactccatttagagtagcgaggatgtttactcaagaaatatttaatggacttgattat
gctaatttccctgcttgtgctttatacgagaacgagtttaactatactggtgtgctaact
caaaaaaatataactataatgtcattttgtgagcaccattttgtaccttttgaaggtact
gcagaagtttcttttattcctaaaaataataatattatagggctttgtcgtataaatagc
atttgtgactttttttccagacgcccacaaatacaagaaagaatgaccgctcaaatattt
gaggccttaaaattcattttatcgacagaagatgttagtgtgaaaattaaggcaaaacat
gcttgtgtctcacttagaggggtaaataatcaaaattctcaaacatatacacaaatggtt
ggtggagtttttgctaaataa

DBGET integrated database retrieval system