KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1237Help
Entry
FTS_1237          CDS       T02350                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase/dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fti00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209581..1210846
Genome map
AA seq 421 aa AA seqDB search
MQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLN
TAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDILAAEDLILETDKLTIPH
KELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLANTIRMGIVNLSN
QSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPISIEEEFNKLNEFLEYFKS
QLANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECNNIEQKAQLIAKYNKKYVII
HNLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFGFGKKSDTARYL
LENIIEIKRRLELKALVGHSRKPSVLGLTKDSNLATLDRATRELSRKLEKLDIDIIRVHK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatattataggaattggaacaaatagtggttttactatcgaaaatattcatctt
gcaataactgcactagaatcgcaacaaaatataagaatcatcagaaaagcaagcttatac
agtagtaaagctgtccttaaagaagacgctcctaaagaatgggatattagatttttaaat
acagctgtaaaaattagctcttcactaaagcctgatgaacttttagtactcttaaaagac
atagaattaaaaataggtagagacctaaatgctcctgcatggtcacctcgagtaattgat
ttagatattcttgctgctgaagatctaattttagaaacagacaaacttactattcctcat
aaagaactaattaatcgtagttttgcgttggctcctttattagaattatcaaagggttgg
catcaccctaaatatgttgaatgggatcttaatataagattaaaagaattaggtgagata
gtaaaacttaaacaaactcttgcaaatacaatacgtatgggtatagttaatctgtcaaat
caatctttttcagatggtaattttgacgataatcaacgtaaattaaaccttgatgagcta
atacaaagtggtgctgaaattattgatatcggagctgaatcgactaagcctgatgccaag
cctatatcgattgaagaagaatttaacaaattaaatgaattcctagaatactttaaatca
caactggcaaatttgatttataaaccattagtcagtattgacacacgcaaactagaggta
atgcaaaaaattctcgctaagcatcatgatattatctggatgataaatgatgttgaatgt
aataatattgagcaaaaagcacagcttatagctaaatataataaaaagtatgttataatt
cataatttgggtattacagatagaaatcaatatttagataaagaaaatgctatagataat
gtttgtgattatattgagcaaaaaaaacaaattcttctaaaacatggtatagcacaacaa
aatatttattttgatattggctttggttttggtaaaaaatcagataccgctagatactta
ttagagaatatcatcgagataaaaagaagattagaattaaaagcattagttggtcactca
cgtaagccatcagttttaggattaacaaaagatagtaatttagcaactttagatcgagct
acaagagagctttcaagaaaattagagaaactagatattgatattataagagtacacaag
atttaa

DBGET integrated database retrieval system