KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1237Help
Entry
FTS_1237          CDS       T02350                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase/dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTS_1237 (folK)
Enzymes [BR:fti01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FTS_1237 (folK)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FTS_1237 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209581..1210846
Genome map
AA seq 421 aa AA seqDB search
MQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLN
TAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDILAAEDLILETDKLTIPH
KELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLANTIRMGIVNLSN
QSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPISIEEEFNKLNEFLEYFKS
QLANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECNNIEQKAQLIAKYNKKYVII
HNLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFGFGKKSDTARYL
LENIIEIKRRLELKALVGHSRKPSVLGLTKDSNLATLDRATRELSRKLEKLDIDIIRVHK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatattataggaattggaacaaatagtggttttactatcgaaaatattcatctt
gcaataactgcactagaatcgcaacaaaatataagaatcatcagaaaagcaagcttatac
agtagtaaagctgtccttaaagaagacgctcctaaagaatgggatattagatttttaaat
acagctgtaaaaattagctcttcactaaagcctgatgaacttttagtactcttaaaagac
atagaattaaaaataggtagagacctaaatgctcctgcatggtcacctcgagtaattgat
ttagatattcttgctgctgaagatctaattttagaaacagacaaacttactattcctcat
aaagaactaattaatcgtagttttgcgttggctcctttattagaattatcaaagggttgg
catcaccctaaatatgttgaatgggatcttaatataagattaaaagaattaggtgagata
gtaaaacttaaacaaactcttgcaaatacaatacgtatgggtatagttaatctgtcaaat
caatctttttcagatggtaattttgacgataatcaacgtaaattaaaccttgatgagcta
atacaaagtggtgctgaaattattgatatcggagctgaatcgactaagcctgatgccaag
cctatatcgattgaagaagaatttaacaaattaaatgaattcctagaatactttaaatca
caactggcaaatttgatttataaaccattagtcagtattgacacacgcaaactagaggta
atgcaaaaaattctcgctaagcatcatgatattatctggatgataaatgatgttgaatgt
aataatattgagcaaaaagcacagcttatagctaaatataataaaaagtatgttataatt
cataatttgggtattacagatagaaatcaatatttagataaagaaaatgctatagataat
gtttgtgattatattgagcaaaaaaaacaaattcttctaaaacatggtatagcacaacaa
aatatttattttgatattggctttggttttggtaaaaaatcagataccgctagatactta
ttagagaatatcatcgagataaaaagaagattagaattaaaagcattagttggtcactca
cgtaagccatcagttttaggattaacaaaagatagtaatttagcaactttagatcgagct
acaagagagctttcaagaaaattagagaaactagatattgatattataagagtacacaag
atttaa

DBGET integrated database retrieval system