KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1818Help
Entry
FTS_1818          CDS       T02350                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1795335..1795955)
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKVMADIPREIFLPRELQTLAYCDTNLVVNERELR
SPMFTARLIEALAIKVSDNVLKLGLESGYPVALIAKLCKSVELVDYDELGLAVARRQLAS
IGIYNVEFNSAEHITNIIKNGKKYNCIYISEVVTEDEIDESLLGLLETGGRLIFVVRTAI
CDKAYLITKTPKQTYEKSFLFNTYNK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagaaaatatggtaaagcaacaggttcttactgaaggactt
tctttagatggtgttgctaaagttatggcagatattcctagagagatttttttgcctaga
gagcttcaaactttagcttattgcgacacaaatttagttgtaaatgaaagagaattaaga
agtccgatgtttacagctaggcttatagaagcattagccatcaaagttagtgataatgtc
ttaaaacttggtttggaaagtggttatccggtagctttaatagccaagttatgtaaaagt
gttgagcttgttgattatgatgagttagggttagccgtagcaaggcgtcagctagcaagt
attggtatatataatgttgagtttaatagtgctgagcatataactaatattataaaaaat
ggcaaaaaatataattgtatctacatatcagaagttgttactgaggatgagattgatgag
tcgttattagggcttcttgagactggcggtagactgatatttgtcgttagaacagctata
tgtgataaagcatacttaataacaaaaactccaaagcaaacatacgaaaagagttttctc
tttaatacatacaataagtaa

DBGET integrated database retrieval system