KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1849Help
Entry
FTS_1849          CDS       T02350                                 

Gene name
glsA
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fti00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fti00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:fti00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828966..1830507
Genome map
AA seq 513 aa AA seqDB search
MKTIMIKTTSSSGEDYYKNIFSAICDKDGFMTKTDILDILVESGISNDDPRITKLIAKLN
KFCDIDKIDFDTFQEITFENIGLIEKAINKGFIIPNFKDFKKEIEAIYNETKKNETGRNA
NYIPQLARVDPNLFAVAFCSVDGQIITLGDYLQPYCVQSTAKTITYCIATEENGEDKVHQ
HVGREPSGITFNAIALNKYDLPHNPMINSGAIMMCSLIKPEWNIADRFEYITNVWQDLAG
GEPIGFDNAVYHSEKETADRNYALAHFMKEVGAFPEGTNIHTALDFYFQTCSIQVNAKKM
AKIMASIANGGVCPFTSKKIFSPTTIRNCLSMMYSCGMYDFSGEYAFSVGLPAKSGVSGA
LAIAIPNVGGFAIFSPRLDPNHNSVRGVEFSKRLIEKFSFHNYDHITHCDKINPVENRMV
VESNLTFELIWAASAGDLSEIKRAVALGVDINKGDYDKRTALHLAAAEGHEDIVKYLIRK
GADINAIDRWGKKPLDDAIMNNNISIIELLDRT
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaataatgattaaaactacatcttctagtggtgaagattactataaaaatatt
tttagcgctatctgtgacaaagatggctttatgacaaagacagatattcttgatatctta
gttgagtcaggtattagcaatgatgatcctcgcattactaaattaatcgccaaattaaat
aaattctgtgatattgataagattgattttgatacatttcaagaaattacttttgaaaat
ataggtcttatcgaaaaagctattaataaaggctttatcattcccaactttaaggatttc
aaaaaagaaattgaagccatatataacgaaactaaaaagaatgaaacaggcagaaacgca
aactatattcctcaactagcaagggttgaccctaatctttttgctgtggctttttgtagt
gttgatggtcaaataattaccttaggagattatctacaaccatactgtgtacaatcaact
gcaaaaactatcacatattgtatagctactgaagaaaatggcgaagataaagttcatcaa
catgttggcagagaaccaagtggtattacttttaatgctatagcattaaacaagtatgac
ctacctcataatccaatgataaactccggcgctatcatgatgtgctcactaataaaaccg
gagtggaatattgctgatagatttgaatatattactaacgtttggcaagatctagcaggt
ggcgaacctatcggctttgataacgctgtatatcactccgaaaaagagaccgcagataga
aattatgctctagctcattttatgaaagaagtaggtgcttttccagagggcacaaatatc
cacactgctctagatttctatttccaaacttgctctattcaagttaacgcaaaaaaaatg
gcaaaaattatggcttccatagctaatggcggagtatgcccttttactagtaaaaaaata
ttttcaccaacaacgattcggaattgcttatcaatgatgtactcgtgtgggatgtatgat
ttttcaggtgaatatgcgttctctgttggattacctgcaaaatcaggggtgtcaggagct
ctagctatagctattccaaatgttggtggttttgcaattttttctcctcgacttgaccct
aatcataactccgtaagaggtgttgaatttagtaaaaggctaatagagaagtttagtttc
cataactatgatcatataactcattgtgacaaaataaatcccgttgagaatagaatggtt
gtcgaatcaaatttaacatttgaactaatttgggcagcaagtgccggtgacttatcagag
attaaaagagccgttgccttaggtgttgatattaacaaaggtgattatgataaaagaaca
gctcttcacctagccgctgctgaaggtcatgaagatattgttaaataccttatccgcaaa
ggagcagatattaatgctatagacagatggggtaaaaagccattagatgatgctataatg
aataataatatttctataattgagctgttagacagaacttaa

DBGET integrated database retrieval system