KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0028Help
Entry
FTL_0028          CDS       T00331                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FTL_0028
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTL_0028
Enzymes [BR:ftl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     FTL_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(26372..27292)
Genome map
AA seq 306 aa AA seqDB search
MLSFQKLLRGDQIIKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRIIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYFEKGSLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMALL
ALLVIS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattattaaagatgatttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgaatctgctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggtgaaacccttgatgatacaggtagaataattgatcaatatgct
gatattatcgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggcgatggtgaaaatgaacatcccactcagtcattggtt
gacttatatactatctactttgagaaaggctctcttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataat
gcctcgtttaaatttatatcttcaaaagagctacagattcctaagaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtgccgatgttttagaa
gacttagatgtactatatgtaactcgtgtccagagagaaaggtttcctgatgaagaaagc
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattccgattaggatggcgctattg
gctttattagtaatatcctaa

DBGET integrated database retrieval system