KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0091Help
Entry
FTL_0091          CDS       T00331                                 

Definition
O-methyltransferase (EC:2.1.1.104)
Orthology
K00588  
caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Phenylalanine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:ftl00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85149..85565
Genome map
AA seq 138 aa AA seqDB search
MLSSPNQLQLLSLLLKIINVKRVLEIGVFRGFSTLVMAQVLADDATIEACDIGYEYLKPY
EHFWQQAKVEHKINLNIAPALETLDRFLQQQLKFDFVYIDADKPNYINYYEKALALMDSG
GLIAIDNVLWSGRVADKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcttagctcacctaaccagttacagttacttagccttttgctaaaaatcattaatgtt
aaaagggttttagaaataggagtttttcgtggtttttctactttagtaatggcacaagtt
ttagctgatgatgctactattgaagcctgtgatattggctatgagtatcttaagccatat
gagcatttttggcagcaggcaaaagttgaacataagattaacctaaatattgcaccagct
cttgagacacttgatagatttttacagcaacagctaaaatttgattttgtttatatcgat
gctgataagccaaactacataaattattatgaaaaagctttagctctaatggattctggt
gggcttattgctatagataatgtgctttggtcaggtcgggttgctgataaaaaataa

DBGET integrated database retrieval system