KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0091Help
Entry
FTL_0091          CDS       T00331                                 

Definition
O-methyltransferase (EC:2.1.1.104)
Orthology
K00588  
caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Phenylalanine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    FTL_0091
Enzymes [BR:ftl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.104  caffeoyl-CoA O-methyltransferase
     FTL_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85149..85565
Genome map
AA seq 138 aa AA seqDB search
MLSSPNQLQLLSLLLKIINVKRVLEIGVFRGFSTLVMAQVLADDATIEACDIGYEYLKPY
EHFWQQAKVEHKINLNIAPALETLDRFLQQQLKFDFVYIDADKPNYINYYEKALALMDSG
GLIAIDNVLWSGRVADKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcttagctcacctaaccagttacagttacttagccttttgctaaaaatcattaatgtt
aaaagggttttagaaataggagtttttcgtggtttttctactttagtaatggcacaagtt
ttagctgatgatgctactattgaagcctgtgatattggctatgagtatcttaagccatat
gagcatttttggcagcaggcaaaagttgaacataagattaacctaaatattgcaccagct
cttgagacacttgatagatttttacagcaacagctaaaatttgattttgtttatatcgat
gctgataagccaaactacataaattattatgaaaaagctttagctctaatggattctggt
gggcttattgctatagataatgtgctttggtcaggtcgggttgctgataaaaaataa

DBGET integrated database retrieval system