KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0209Help
Entry
FTL_0209          CDS       T00331                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTL_0209
   00240 Pyrimidine metabolism
    FTL_0209
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FTL_0209
   03430 Mismatch repair
    FTL_0209
   03440 Homologous recombination
    FTL_0209
Enzymes [BR:ftl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FTL_0209
DNA replication proteins [BR:ftl03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FTL_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208527..208964
Genome map
AA seq 145 aa AA seqDB search
MKIEFKVLQTQDINQMLEVLITEVVKEYALQKIIAILAPAGIAKQLDDKLWQDGQDSFIP
HHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQDS
ALQASRKKYVYYKKSNLEIITVQDN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtgctg
attactgaagttgtcaaagaatatgctttacaaaagataattgcaatcttagcaccagca
ggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatccca
catcattgtgctataaatgctagagagtataatcaatataataatattccaattcttatc
acagataatctatttattacctcaggttatgatgttttaataaatattatggatgtggct
gtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagatagc
gctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagataatt
actgttcaagataactaa

DBGET integrated database retrieval system