KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0223Help
Entry
FTL_0223          CDS       T00331                                 

Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ftl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ftl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224465..225007)
Genome map
AA seq 180 aa AA seqDB search
MLKYIKMTKNRFLKMISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKT
FESIGRPLPNRKNIILTRNKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEF
LKYADRLYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKNDKNEFDFTFSIFEKNKNL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatacatcaaaatgactaaaaatagatttctcaaaatgatctcactaatcgtt
gcttatgataaaaactttggtataggtaaagaaaatactctagcatggaaactatcagaa
gatcttaagaactttaaaaaaataacagaaaacaactatattgttatgggtagaaaaacc
tttgaatcgattggtcgcccactaccgaatcgtaaaaatattattttaactagaaacaaa
gattacaaacaagataaatgtttaataataaatagtactcaggatattttaaattttgct
gaatcaaaaccacactacgaaatatttataatcggtggtgcacagatctataaagaattt
ctaaaatacgcagatagattgtatataaccgaagttgatgcagaaatgactgatcttgat
gctttctttccacaatgggataaatcaaaatataaacgtattggtcacaaacaattcaaa
aaaaatgataaaaatgagtttgactttacatttagcatctttgaaaaaaataaaaatttg
taa

DBGET integrated database retrieval system