KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0488Help
Entry
FTL_0488          CDS       T00331                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ftl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472821..474284
Genome map
AA seq 487 aa AA seqDB search
MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVLPLTTLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFKDNYLEEAFSNFQSSKD
KFEQEYNDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKNWVKEKAIELDQFQQEID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEVFLLDEDQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKFKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPASEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRDEVFELRDHYNLKGMKV
FPFHFDLKTARLIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGAPNWEWKLVDFNLLKSKTNRLAKQ
VSKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagctggattattattagctatttcaagtttacctagctggtttggcattggt
gatttgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctagtattagaatt
tggcaggttttacctcttacaacactaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgcaaactctaaaaaagttgaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcatttagtaatttccaaagctcaaaagat
aagtttgaacaagagtataatgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggaatttttggcctgcagaa
tataaaaactgggtcaaagagaaagctatagaacttgatcaatttcaacaagagatagat
tatcaaatatttttacagtttatattttataagcagtggtttgagctaagagagtatgct
aataaaaataatattgaaattatgggtgatttgcctatttatctaggttttgattctgct
gatgtgtgggagcatcaagaagtatttttattagatgaggatcaaaatcctagctttgtt
gcaggagttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataaattcaaagaaacaaattttgatttttggatagatcgactaaatggtaat
ttcaagctatttgatattgttaggattgaccattttagagcttttgatacatattggaag
ataccagccagtgaaaaaactgctataaatggtgagtgggtagaagctcctggctatgat
ttctttgatacagtctataagcgtattccagatgctaatattattgcggaagatttagga
gatttgcgagatgaagtatttgagctacgtgatcactataatttaaagggtatgaaagta
ttcccatttcattttgatctaaaaacagctagattgattgatgatgctaatatcatagct
tattcaggtactcacgataataatactttgaaaggttggtattttgacgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtactgtaggtgcgccaaactgg
gagtggaagttggttgattttaatttacttaagtcaaaaactaatcgcttagctaaacag
gtatctaagtctataaatcattaa

DBGET integrated database retrieval system