KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0490Help
Entry
FTL_0490          CDS       T00331                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FTL_0490
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FTL_0490
Enzymes [BR:ftl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     FTL_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475477..476940
Genome map
AA seq 487 aa AA seqDB search
MKRINQILKFLDIKTLSQNNFQIESLYLDSRKCDKKSVFVALKGLSTDGNKYIDSVLAKG
VSLVLTDSHEFEDQKRVFYIQNLKEKLSTLAKWFYDYEKPQNIIGITGTNGKTSISSYIA
QFLDLSAQKTLLLGTNGNGIYPDLRESTHTTLDILSLYKTISYYKNYQNLVMEVSSHSLD
QKRVEGLDFDVAIFSNLSHDHLDYHKTMDNYFEAKAKLFQFKRLKKAIINIDDEYGQRLC
NMTQVPVITVSLKSEYADVYIKPKSIEGIKTKFEMFFNGRFVGEYTTKLIGDFNLMNLGL
SFASLDGVLDWDCILDLGNIKPVKGRMEVIELDNDIKIVIDYAHTPDALEKALQTLNSYN
PNNLWCIFGCGGNRDTSKRPIMAQIAEEYASKIVITEDNNRFESIENIFSDIRKGFKYPQ
KHIFITSREQAIRFSIENANQGDIILLASKGHECYLDKNGAKEYFDEREIIKKYAGAFSL
NMINKEI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataaaccaaatattaaaatttctagatattaaaactttatctcaaaataat
tttcaaattgagtctctatatttagatagtcgtaaatgtgataaaaaatcagtgtttgta
gctctcaaaggtctatcaactgatggtaataaatatattgatagtgttttagctaaaggt
gtcagtttagtattaacagatagtcatgaatttgaagaccagaaacgtgttttttatatt
caaaatttaaaagagaaactatcgacccttgcaaaatggttttatgattatgaaaaacca
caaaatataataggtataactggcacaaatggtaaaacttctatctctagttatattgct
caatttttagatttaagtgcacaaaaaacgctacttttaggtacaaatggcaatggcatt
tatcctgacttaagagagagtacacatacgacattagatatattgtctttgtataaaact
atttcatattataaaaattatcaaaatcttgtgatggaagtatcttctcattcattagac
caaaagcgtgttgaaggcttagattttgatgttgctatatttagtaatcttagccatgat
catcttgattatcataagactatggataattattttgaagctaaggcaaaattgtttcaa
ttcaaaagacttaaaaaagctataataaatatagatgatgagtatggtcaaagactgtgt
aatatgacacaggtaccggttattacagtaagtctaaaatctgaatatgctgatgtctat
attaagcctaaatctatagaaggtattaaaactaagtttgaaatgttttttaatggtagg
tttgttggtgaatatacaactaagcttatcggcgattttaacttgatgaatttgggcttg
agctttgcatcacttgatggtgtgttagattgggattgtatattagatctaggaaatatc
aaaccagtgaaaggtcgaatggaagtgatagagctagataatgatataaagatagttatt
gattatgcgcatactccagatgctttagaaaaggctttacaaaccttaaatagctacaat
ccaaataatttatggtgtatttttggctgtggtggtaatagagatacttccaaaagacct
ataatggcacaaatagcggaagaatatgctagcaaaatagtaattacagaagataataat
cgttttgagagtattgaaaatatattcagtgatattagaaaaggatttaagtatccgcaa
aagcatatttttatcacctctcgagaacaagctattaggtttagtatagaaaatgctaat
caaggagatattattttattagcaagtaaagggcatgagtgttaccttgataaaaatggt
gctaaagagtattttgatgaacgagaaatcataaaaaaatatgccggagcattctctttg
aatatgataaataaagaaatataa

DBGET integrated database retrieval system