KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1281Help
Entry
FTL_1281          CDS       T00331                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ftl00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ftl00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220604..1221203
Genome map
AA seq 199 aa AA seqDB search
MDVTNEDQVKSGVDETVKKFGRIDTVINNAGIQIISPIVDFSISAWKKLFDIHMTGILLV
TQAAMRHMIELKTGGRIIVVGSVHSVLASKNKAAYVAAKHAQVGFVRALAKEGAEHNISS
NLIGPGFVMTPLVEKQIPEQAKELNISEEEVVKNIMLSGTVDGEFTTVQDIADTAIFLAG
FKTNALTGQKILVSHGWGM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggatgttacaaatgaagaccaagtgaaatccggtgtagatgaaactgtcaaaaaattt
gggcgtattgatactgtaattaataacgcaggtattcagataatatcacctatagtagat
tttagtatatcagcttggaaaaaattatttgatattcatatgactggtatattacttgtg
actcaagcagctatgagacatatgattgaactaaaaactggtggtagaattatagttgta
ggttctgttcactcagttcttgcatcaaaaaataaagcagcttatgtagcagctaaacac
gcacaagttggttttgtaagagctttagcaaaagaaggtgctgagcacaatatctcatct
aacctaattggtccaggttttgtgatgacgccattagtagaaaagcaaattccagagcaa
gcaaaagagctaaatatttccgaagaagaagttgtcaaaaatattatgcttagtggcact
gtagatggtgagttcacaacggtccaagatatcgctgatacagccatattcttagctgga
ttcaaaaccaatgctctaacaggtcagaaaattttggtaagtcatggttggggaatgtaa

DBGET integrated database retrieval system