KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1281Help
Entry
FTL_1281          CDS       T00331                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FTL_1281
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    FTL_1281
Enzymes [BR:ftl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     FTL_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220604..1221203
Genome map
AA seq 199 aa AA seqDB search
MDVTNEDQVKSGVDETVKKFGRIDTVINNAGIQIISPIVDFSISAWKKLFDIHMTGILLV
TQAAMRHMIELKTGGRIIVVGSVHSVLASKNKAAYVAAKHAQVGFVRALAKEGAEHNISS
NLIGPGFVMTPLVEKQIPEQAKELNISEEEVVKNIMLSGTVDGEFTTVQDIADTAIFLAG
FKTNALTGQKILVSHGWGM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggatgttacaaatgaagaccaagtgaaatccggtgtagatgaaactgtcaaaaaattt
gggcgtattgatactgtaattaataacgcaggtattcagataatatcacctatagtagat
tttagtatatcagcttggaaaaaattatttgatattcatatgactggtatattacttgtg
actcaagcagctatgagacatatgattgaactaaaaactggtggtagaattatagttgta
ggttctgttcactcagttcttgcatcaaaaaataaagcagcttatgtagcagctaaacac
gcacaagttggttttgtaagagctttagcaaaagaaggtgctgagcacaatatctcatct
aacctaattggtccaggttttgtgatgacgccattagtagaaaagcaaattccagagcaa
gcaaaagagctaaatatttccgaagaagaagttgtcaaaaatattatgcttagtggcact
gtagatggtgagttcacaacggtccaagatatcgctgatacagccatattcttagctgga
ttcaaaaccaatgctctaacaggtcagaaaattttggtaagtcatggttggggaatgtaa

DBGET integrated database retrieval system