KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1282Help
Entry
FTL_1282          CDS       T00331                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ftl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ftl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221264..1222931
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVIDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFANAVDNVYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDQTNYTKTSLKINIQTTLEN
IFGNKEIKGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaattaattatgatggattttcgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtactagtggt
tgcggtaatatggcactagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctgtggat
gttaactctaacaaaaataatcctattattggtgtaagatcatactcagataatcctgat
atagttattgactacgccaaaaatgctataaatggttatcatgatgcaaaaattatagac
tgcattaaacatttccctggtcatggtgatactgcaacagatagtcatttaggcaatgta
aacttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgtaccagccctagatgacacc
cagtatcaatcagtttcaacaagtgagaatatttatgtgccagccaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaaggatataatcaaaattctaattttgct
aatgcagttgataatgtctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtattagacaat
aactcaaatgttattattaactgcgaaaatattaataaccataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcaacttctatg
gatcagacaaactatacaaagacttcactaaagattaatattcaaacaacattagaaaat
atttttggtaataaagagattaaaggagtactaccagtcagtttataa

DBGET integrated database retrieval system