KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1543Help
Entry
FTL_1543          CDS       T00331                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ftl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1473082..1473906
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVKRGLIKTIIDKKIFDIEINTDKLRYPIDKDQLVKIKNKVVKEIQRRGKHL
IIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLSDNLSLVYNDPRKFGYWLVN
TNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEA
LFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLN
VYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttcctgaagtagaaacagtaaaaagaggcttaattaaaactattatcgat
aaaaagatatttgatattgagattaataccgataagcttcgctaccctattgataaagac
caattagtaaaaattaaaaataaagtagtcaaagaaatacaacgcagaggtaagcattta
ataattttcattgaagatgatttacaattaattattcacttaggcatgtctggaattatt
aaagttatagactcaacaaactacaataaaatcaaacatgatcacatcgttgtaacgcta
tcagataatctatctttagtttacaatgatccacgtaaatttggttattggttagtaaat
actaatcacacacctcttgaacatagagttttagtatcacatggtgttgaaccactaaca
gctgattttaatagtgactatctagtttctaaacttaagcaaacatcaagaaaaatcaaa
caaacgattatggataataatattgtcgttggtgtgggtaatatatatgctagtgaggcg
ctatttgatagtaatatcctaccaacaagagcttctaatactattaccaaaaaagaagca
gctaacctagtatcatctataaaaaaaatactggaaaaagctattacacaaggtggaacc
actcttaaagattataaaaacaccgagggtaaacccggttattttactcaacaactaaat
gtctatggtagaaatgaacaacaatgttatgtatgtaatacaaaaatacaaagtctagtt
atagctcaaagaaatacttttttttgtaaaaagtgtcagaaataa

DBGET integrated database retrieval system