KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1644Help
Entry
FTL_1644          CDS       T00331                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FTL_1644
Enzymes [BR:ftl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FTL_1644
Exosome [BR:ftl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTL_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1574234..1575742)
Genome map
AA seq 502 aa AA seqDB search
MSKDFILAIDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSIFIVGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKINEITSLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKAWAECYS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttcatcttagctatagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgcagcaataggtattaca
aatcagcgcgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcaagtatttgtgatgaaatcaaacgagatcctcaa
tttgtcaaatatatcaaagaaaatactggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataacgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggtactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaatagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctgaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggtggtgctgagattcctatt
gctggtgttgcaggagatcagcatgcagcattatttggtcattgctgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgcgttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactattgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtatatttatagtaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggcattacccgtgatacaaagcgtgagcatattattcgtgca
gctctagaggctatagcatatcaagctaaagatgtcttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccgaaaataaatgaaattact
agtttgggggctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgaaccgcaaaaagactctcaagctgtt
gctcatgattatagaggttggaagaaagcagtagaaagaagtaaggcttgggcagagtgt
tatagttaa

DBGET integrated database retrieval system