KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1780Help
Entry
FTL_1780          CDS       T00331                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl00010  Glycolysis / Gluconeogenesis
ftl00051  Fructose and mannose metabolism
ftl00562  Inositol phosphate metabolism
ftl01100  Metabolic pathways
ftl01110  Biosynthesis of secondary metabolites
ftl01120  Microbial metabolism in diverse environments
ftl01130  Biosynthesis of antibiotics
ftl01200  Carbon metabolism
ftl01230  Biosynthesis of amino acids
Module
ftl_M00002  Glycolysis, core module involving three-carbon compounds
ftl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTL_1780
   00051 Fructose and mannose metabolism
    FTL_1780
   00562 Inositol phosphate metabolism
    FTL_1780
Enzymes [BR:ftl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTL_1780
Exosome [BR:ftl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTL_1780
  Exosomal proteins of bladder cancer cells
   FTL_1780
  Exosomal proteins of melanoma cells
   FTL_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: CAJ80219
UniProt: P96763
Structure
PDB: 

Jmol
Position
complement(1710663..1711424)
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRKSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaaaattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagaaaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagctagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggtacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgttgacggtggtttaattggtggcgcatctttgaaggctgcagaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system