KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1780Help
Entry
FTL_1780          CDS       T00331                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTL_1780
   01230 Biosynthesis of amino acids
    FTL_1780
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTL_1780
   00051 Fructose and mannose metabolism
    FTL_1780
   00562 Inositol phosphate metabolism
    FTL_1780
Enzymes [BR:ftl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTL_1780
Exosome [BR:ftl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTL_1780
  Exosomal proteins of bladder cancer cells
   FTL_1780
  Exosomal proteins of melanoma cells
   FTL_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1710663..1711424)
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRKSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaaaattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagaaaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagctagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggtacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgttgacggtggtttaattggtggcgcatctttgaaggctgcagaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system