KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1958Help
Entry
FTL_1958          CDS       T00331                                 

Definition
(GenBank) tryptophan biosynthesis protein
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftl01100  Metabolic pathways
ftl01110  Biosynthesis of secondary metabolites
ftl01130  Biosynthesis of antibiotics
ftl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTL_1958
Enzymes [BR:ftl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FTL_1958
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     FTL_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAJ80397
Position
complement(1886466..1887827)
Genome map
AA seq 453 aa AA seqDB search
METILEKIVEAKRKWLFAKKRLFPLDVFKKEVVKTDRDFYQALESDKAVFILECKKGSPS
KGIIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDE
YQIFLARHYQADAVLLMLSVLDDSEYKKLAKVANRLGMGILTEVSNEEELVRAISLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKRTIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
GERNLELAVRKLVYGFNKVCGLTSVEDAQKAYDAGAVYGGLIFVEKSPRYVDFAMAKQIV
KKVRLNYVGVFADAKIEDVVDTCYALKLSAVQLHGDENQEYIDTLKSKLHRNCQIWKAYP
VDKTLPSFFANVDYHLLDAQVDGKSGGTGKTFDWSLIKDRKNIILAGGLNAKNIAKAIEL
KCSAYDINSGVESEPGQKDQIKLNEVFEIIRSY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattttagaaaaaatcgttgaagcaaaaagaaagtggctttttgcaaaaaaa
agactatttccactagatgtatttaaaaaagaagttgtcaaaacagatagagatttctat
caagctttggaatctgataaagctgtatttattttagaatgtaaaaaaggctctccttct
aaaggaattattcgtaaaaagtttgatctaaatgaaattgcagctgtatacaaaaattat
gcaaatgtgatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaacacaacctatgctttgtaaagattttataatagatgaa
tatcaaatattcttagctaggcattatcaagctgatgctgtgttacttatgctttcagta
cttgatgatagtgagtataaaaaattagcaaaagttgctaatcgtctaggtatgggtata
ttaaccgaagttagtaacgaagaagagcttgtaagagctataagcttaaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatttaaatactacgcgtctt
ttagctccgaaaatacctaaaagaacaattattatttcagaatcagggatctataaaaat
caagaaatacgtgatctaagaaattatgtaaatggctttttgataggaagttctattatg
ggtgaacgtaaccttgaacttgcagttagaaagcttgtttatggttttaataaggtttgc
ggccttacttctgttgaggatgctcaaaaagcatatgatgcaggagcagtctatggtggt
ttgatttttgttgagaaatctcctcgttatgtagattttgccatggcaaaacagatagta
aaaaaagttaggctaaattatgtaggtgtttttgctgacgctaaaatagaagatgttgta
gatacctgctatgcattaaaattaagtgctgtgcagttgcatggtgatgaaaatcaagag
tatatagatactctaaaatcaaagctacatagaaactgtcaaatatggaaagcatatcca
gtagataagactcttccaagtttttttgctaacgtagattatcatttattagatgcccaa
gtagatggtaaatcaggtggtacaggaaaaacatttgattggagtcttatcaaagacaga
aaaaatataattcttgctggcggtctgaatgctaaaaatatagcaaaagcaatagaattg
aagtgttcagcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcaa
atcaaactaaatgaagtatttgaaataattagaagttattaa

DBGET integrated database retrieval system