KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0058Help
Entry
FTM_0058          CDS       T00698                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTM_0058 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTM_0058 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTM_0058 (trpA)
Enzymes [BR:ftm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTM_0058 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63043..63852
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEILDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCL
DAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgcaaatttagagaaaagaaatgaaggagctttt
ataccttttgtaacaattggtgatcctaataaagcgctatcctttgaaattctcgatact
ttggttagttcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaa
gattgtttcgatattctaactaaaataagagcaaaataccctcatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gatgcaggtgttgattctatacttatagctgatgtacccgctcacgaatctaaagagttt
cgtgatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagt
gagtcaactcttaagcaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattggctaaa
cttagagaatataatgctcctaaaccagttttaggctttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgagcttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system