KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0058Help
Entry
FTM_0058          CDS       T00698                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00260  Glycine, serine and threonine metabolism
ftm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01130  Biosynthesis of antibiotics
ftm01230  Biosynthesis of amino acids
Module
ftm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTM_0058 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTM_0058 (trpA)
Enzymes [BR:ftm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTM_0058 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACD30167
UniProt: B2SEK8
Structure
PDB: 

Jmol
Position
63043..63852
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEILDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCL
DAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgcaaatttagagaaaagaaatgaaggagctttt
ataccttttgtaacaattggtgatcctaataaagcgctatcctttgaaattctcgatact
ttggttagttcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaa
gattgtttcgatattctaactaaaataagagcaaaataccctcatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gatgcaggtgttgattctatacttatagctgatgtacccgctcacgaatctaaagagttt
cgtgatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagt
gagtcaactcttaagcaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattggctaaa
cttagagaatataatgctcctaaaccagttttaggctttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgagcttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system