KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0137Help
Entry
FTM_0137          CDS       T00698                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00020  Citrate cycle (TCA cycle)
ftm00190  Oxidative phosphorylation
ftm00650  Butanoate metabolism
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01120  Microbial metabolism in diverse environments
ftm01130  Biosynthesis of antibiotics
ftm01200  Carbon metabolism
Module
ftm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTM_0137 (sdhD)
   00650 Butanoate metabolism
    FTM_0137 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FTM_0137 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: ACD30235
Position
146114..146482
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggcgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttctgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system