KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0144Help
Entry
FTM_0144          CDS       T00698                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTM_0144 (tpiA)
   01230 Biosynthesis of amino acids
    FTM_0144 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTM_0144 (tpiA)
   00051 Fructose and mannose metabolism
    FTM_0144 (tpiA)
   00562 Inositol phosphate metabolism
    FTM_0144 (tpiA)
Enzymes [BR:ftm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTM_0144 (tpiA)
Exosome [BR:ftm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTM_0144 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTM_0144 (tpiA)
  Exosomal proteins of melanoma cells
   FTM_0144 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155257..156018
Genome map
AA seq 253 aa AA seqDB search
MQKLIMANWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDEKLAKNIKIVYGGSLKAENAKDILSLPNVDGGLIGGASLKAVEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatggctaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaaaacttgct
aaaaatataaaaatagtgtacggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccaaatgttgacggtggtttaattggtggcgcatctttgaaggctgttgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system