KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0213Help
Entry
FTM_0213          CDS       T00698                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FTM_0213
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FTM_0213
Enzymes [BR:ftm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FTM_0213
Lipid biosynthesis proteins [BR:ftm01004]
 Desaturase
  First
   FTM_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237396..238562
Genome map
AA seq 388 aa AA seqDB search
MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYGFSTSDYVCLVVFYMLT
GVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSSDHRKHHKDVDDPIKDP
YAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHNHYTVLAILSCFGLPALL
GFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHATFCINSLAHTIGKRPYSTKNTAR
DSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFIAGLAKIGWCYDLKTTPKHL
IEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMYNAKQEYLKAKKDNVLSKADI
KEIKSKYKDLKIEFIQAKKKYNKASTIA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgaaataatacaccaaaccatagaaaaacaaggtagcatagtctggaag
agtgtttttgggttgctacttctaccattggtggcgcttatagctattccttggtatgct
atgacttatggcttttcaacatcagattatgtatgtctagtagtcttctatatgcttact
ggtgttggtattacaatgggttaccatagactgtggtcacataaaacatataaggcaaac
aaaatagtaagttatgctcttttattatttggcacagcagcactacaaaatagtgtaatt
cagtggtcttcagatcacagaaaacaccataaagatgttgatgatcctatcaaagatcca
tatgctgctacacgtggtttctggttttcacattttggctggttactaagacatagtagt
cctgatgttcaggaaatcagaggtgtaaatgatcttctaaaagataaggcactagtattt
cagcataatcattacactgttttagcgatattatcgtgttttgggttgcctgcattgcta
ggttttatattcggattcttgagcggtcatacacttacggctgcttggcacagtgcttta
ggctttttactattaggtggcctacttagagttatattggttcatcatgcgactttttgt
atcaactctctagcacatactattggtaaaagaccttattctacaaaaaatactgctagg
gatagctggataacagctatagtaacaggtggtgagggttatcataattatcaccatgct
tttgctggtgattatagaaatggtattagatggtttgatttagacccatctaagtggttt
attgctggcttagctaagattggttggtgttatgatcttaagacaacacctaagcattta
attgaaattgctaaagcaaaagttaaattagaagaagcattaactaagaaaaataaaact
ttccatctaggtattgaagagaagtatgctaagcttgttgcaaatgttaaaaatatgtat
aacgctaagcaagagtacttaaaagctaagaaagataatgttttatctaaagctgatatt
aaggagattaaatcaaaatataaagatttaaaaatcgaattcattcaagctaagaaaaaa
tataataaagctagtactatcgcctaa

DBGET integrated database retrieval system