KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0320Help
Entry
FTM_0320          CDS       T00698                                 

Definition
type III restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Brite
Enzymes [BR:ftm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     FTM_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353839..356565
Genome map
AA seq 908 aa AA seqDB search
MLFEKQQYQEDCVNNIVNILDECDVFNNDYSNLKNIIKEHYKTQRYSQFETSSKKQIDVL
METGTGKTFTYIKTIFEINKQFGKTKFIIVLPRTAIKQGVIQNIKLTDEYFYNEYGKHLK
FIDYTGKDSLSAVQQSFICNESDLTVLVSTNSAFNKDANTINQAKEDLVEHSSVWEAIAD
KKPIVFIDEPHLLKGGATVEALEKLDSLFIRFGATYPTEEEHKLVNVAYALDSINSFENY
LVKRIAVKNILTGAEESDIKITKINAKEIFFSNGDTKKVSESYELNDDEIEQMLRVTVSN
HFEKEERLFNQGIKELSLFFIPSIADFRGDNPRVRKFFEKIYREIRDEYYHNTTNQEYKK
YLDKDFKDGKLQVLEGYFSGDKGDSAKDDDLKKAVDIILNKKEQLLSLDEPLRFVFSVWA
LQEGWDNPNIFNICKLATTDKETSRRQQVGRGLRLAVNQAGKRQSFKTLAENENAFYDIN
TLDVVVSGYEKDFIEGIQSEIQKASFGIVGDFLENSLLEANGLNLREVSKLINTLEDNQI
IEFDESIEKYKIISSIYDFIENNADKLSFLSNDRLQEIKQLFKSRKSLIEDKNKTIEKLK
IRQEQAKKFKELWETINRKAEIVYKDINELDIINKIADAFDTENFSQIDTKVITKVYDPI
KDKVVTKEEQSLGKIDFFAKNKLSEFVFEFSKKEKLPLGFVTKLFSKLDLQKIKNNPSKA
INFIKTQIKESIHTSILQCVDYDFSQTNIFSKNILQNDDGSFIKEIEYTKLGRNIGDEAS
DEFLFDRVVYDSDIEKQAILNDPTSIDGQQITVFAKLPSISMPTPYKAYNPDFAYLVDRG
KNQKQLFLVVETKGYKNNSDIPQAEKTKIDYAKKFFEGLQKQLPDVEIRFKTRVNKQELS
NILQEYQK
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgctatttgaaaaacaacagtatcaagaagattgtgtaaataatatcgtaaatatttta
gatgagtgcgatgtctttaataatgactattcaaatctaaaaaatataatcaaagaacat
tataaaactcaaagatacagccagtttgaaacatccagtaagaagcaaatagatgtttta
atggaaactggtacaggtaaaacatttacctatataaaaactatttttgagataaacaag
caatttggcaagactaaatttattatagtgctacctcgtacagccattaaacaaggtgtt
attcaaaatatcaaacttactgatgaatatttctataatgagtatggtaagcatttaaag
tttatagactatacaggtaaggatagtttatcagcagtacagcaaagttttatttgtaat
gaatcagatttaacagttcttgtgtctaccaattcagcatttaataaggatgctaataca
attaaccaagctaaagaagatcttgttgagcatagtagtgtatgggaagcaatagcagat
aaaaagccaatagtgtttatagatgagccacatttattaaaaggtggtgccacagttgaa
gctttagaaaagttggatagcttatttattcgttttggtgctacataccctacagaagag
gagcataagcttgtaaatgttgcttatgctttagatagtattaactcatttgaaaactat
ttagtaaaaagaattgcagttaagaatattctaacaggtgcggaagagtcagatattaaa
atcacaaagataaatgcaaaagaaatatttttctctaatggagatactaaaaaagttagt
gaaagctatgagttaaatgatgatgagattgagcaaatgcttagggttacagtttctaat
cattttgaaaaagaagaaagactttttaatcaaggtattaaagagttatcactatttttt
attcctagtattgcagattttagaggagataatcctagagttagaaaattttttgagaaa
atatatcgtgagattcgtgatgagtattatcacaacacgactaatcaagagtataagaaa
tatctagataaagactttaaagatggcaaactacaagttttagaagggtacttctcaggt
gataagggtgatagtgcaaaagatgatgatctaaaaaaagcagtggatattattcttaat
aaaaaagaacaattattatcgcttgatgaacctttaagatttgttttctcagtatgggct
ttgcaagagggttgggataaccctaacatttttaatatttgtaaacttgcaactacggat
aaagaaacatctagaagacagcaagtaggacgtggacttagattagctgttaatcaggca
ggaaaaagacagtcatttaaaaccttggcagaaaatgaaaatgctttttatgatattaat
acccttgatgtggtggtttcaggctatgaaaaagactttatcgaaggtatccaatcagaa
attcaaaaagctagctttggtattgttggagacttcttagaaaatagcttattagaagca
aatggactaaatttaagagaagttagcaaattaataaataccttagaagataatcaaatt
attgaatttgatgagtcgattgagaagtataaaattattagcagcatttatgattttata
gaaaataatgctgataaattatctttcttatctaatgataggttgcaagaaataaaacaa
ctgtttaagtctagaaaatctcttattgaagataaaaataaaacaatagaaaaattaaaa
attcgccaagaacaagctaagaaattcaaggagctatgggagactattaatcgcaaagca
gaaatagtttataaagatataaatgagctagatattatcaacaaaatagcagatgctttt
gatacagaaaacttttctcagatagatacaaaggttataacaaaagtttatgatcctata
aaagacaaggttgttaccaaagaagagcaatctctaggtaaaattgatttctttgctaaa
aataaacttagtgaatttgtatttgagttctctaaaaaagaaaaacttcctctagggttt
gttacaaaattattcagtaagcttgatttgcaaaagataaaaaacaatccaagcaaagct
attaactttataaaaacacaaataaaagagtctattcatacgagtattttacaatgtgtt
gattatgattttagccaaacaaatatatttagtaaaaatattctgcaaaatgatgatggt
agttttatcaaagaaattgaatacactaaactaggtagaaatattggagatgaggcgtct
gatgagtttttatttgatcgagttgtttatgattcagacatagaaaaacaggcaatattg
aatgatcctacttcaatagatggtcagcaaataacagtttttgcaaaactaccaagtata
tctatgccaacaccatacaaagcatataatccagattttgcttaccttgttgatagaggc
aaaaaccaaaagcaattatttttagtggttgaaactaaaggctataaaaataatagtgat
atccctcaagctgaaaaaacaaaaatagattatgctaaaaagttctttgaaggtttgcag
aagcaattacctgatgttgaaattagatttaaaaccagggtaaataaacaggaattgtct
aatattttacaggagtaccaaaaatga

DBGET integrated database retrieval system