KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0520Help
Entry
FTM_0520          CDS       T00698                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTM_0520 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTM_0520 (glk)
   00052 Galactose metabolism
    FTM_0520 (glk)
   00500 Starch and sucrose metabolism
    FTM_0520 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    FTM_0520 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTM_0520 (glk)
   00524 Butirosin and neomycin biosynthesis
    FTM_0520 (glk)
Enzymes [BR:ftm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTM_0520 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
568137..569153
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNMMKDFPVHIIMNTDVSLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatatcattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtcttgcagtagctggatttgtctctaatggtgaagttgaagtgactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaagaaggtaaaaaagatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgatgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcattatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagagccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacatgatgaaagattttccagtgcatataattatg
aacacagatgtcagtttaataggcgcgcgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system