KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0742Help
Entry
FTM_0742          CDS       T00698                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00230  Purine metabolism
ftm01100  Metabolic pathways
Module
ftm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTM_0742 (gmk)
Enzymes [BR:ftm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FTM_0742 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_23 AAA_33 AAA_22 MMR_HSR1 AAA_16 AAA_18 RsgA_GTPase DUF4921 ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: ACD30718
Position
807297..807869
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIVSAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEIDWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQAQSEISHADEYDYLLVNDDFSQSLEQL
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttatagtttctgcaccatctggcgcgggtaaaagttctttacta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattgactggcaaggtgcacaacaaacacgcgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagcacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaatta
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system