KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0749Help
Entry
FTM_0749          CDS       T00698                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FTM_0749
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FTM_0749
Enzymes [BR:ftm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FTM_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814287..814757
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCN
SFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETVVRYAPKTIPEDLIPDIDNFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgactttaagctaactgcaaatgatggttcagaatatcatctgcctaaa
aataaagtgcttttgatagttaatgttgcgagtaagtgcggttttactaagcagtatagg
ggtttgcaacatttacataaaatatatccagatttagaaattgttgcattcccttgtaat
tcatttggtggacaggagccaggtagtgacgaagaaatcaagaatttctgtgaaactaat
tataatgtcacatttccaattatgaaaaaaaccaaagtaaatggtaaagatgctgagcca
ttgtttgagtatctcaaagaaagagcaaaaggagtcttaggaactgaagctataaagtgg
aatttcactaagtttttagtatcaaaagatggcgagaccgtcgtaagatatgcacctaaa
actattccagaagatttaattccagatattgataattttctaaaagactaa

DBGET integrated database retrieval system