KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0772Help
Entry
FTM_0772          CDS       T00698                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00040  Pentose and glucuronate interconversions
ftm00052  Galactose metabolism
ftm00500  Starch and sucrose metabolism
ftm00520  Amino sugar and nucleotide sugar metabolism
ftm01100  Metabolic pathways
ftm01130  Biosynthesis of antibiotics
Module
ftm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FTM_0772 (galU)
   00052 Galactose metabolism
    FTM_0772 (galU)
   00500 Starch and sucrose metabolism
    FTM_0772 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FTM_0772 (galU)
Enzymes [BR:ftm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FTM_0772 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACD30738
Position
836375..837238
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggcactagatttttaccagct
actaaatcatgtcctaaagaaatgctaacagttgttgataaaccattgatccaatatgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aaatccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcctaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatattacctgatgatttaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggcggtagaaggtactgatattagaggttgt
atcgcaactcaacaagtcaagagagaaaaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtgggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggcgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggtactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system