KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0998Help
Entry
FTM_0998          CDS       T00698                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTM_0998 (folE)
Enzymes [BR:ftm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FTM_0998 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080447..1081067
Genome map
AA seq 206 aa AA seqDB search
MMMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFE
KTPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGT
AEVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKH
ACVSLRGVNNQNSQTYTQMVGGVFAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgaaagataaatattgctctaaattaggtaaaagtgtccaagaacatctcatc
aagttaggtttagagcaacctagagaatttaaccttgataatgataataaaataaccata
atcaccaaagcataccgacaaatcttagatgctctcggcttatacacagatgaatttgaa
aaaactccatttagagtagcgaggatgtttactcaagaaatatttaatggacttgattat
gctaatttccctgcttgtgctttatacgagaacgagtttaactatactggtgtgctaact
caaaaaaatataactataatgtcattttgtgagcaccattttgtaccttttgaaggtact
gcagaagtttcttttattcctaaaaataataatattatagggctttgtcgtataaatagc
atttgtgactttttttccagacgcccacaaatacaagaaagaatgaccgctcaaatattt
gaggccttaaaattcattttatcgacagaagatgttagtgtgaaaattaaggcaaaacat
gcttgtgtctcacttagaggggtaaataatcaaaattctcaaacatatacacaaatggtt
ggtggagtttttgctaaataa

DBGET integrated database retrieval system