KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1008Help
Entry
FTM_1008          CDS       T00698                                 

Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase/dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTM_1008
Enzymes [BR:ftm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FTM_1008
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FTM_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089834..1091096
Genome map
AA seq 420 aa AA seqDB search
MQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLN
TAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDILAAEDLILETDKLTIPH
KELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLANTRMGIVNLSNQ
SFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPISIEEEFNKLDEFLEYFKSQ
LANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECNNIEQKAQLIAKYNKKYVIIH
NLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFGFGKKSDTARYLL
ENIIEIKRRLELKALVGHSRKPSVLGLAKDSNLATLDRATRELSRKLEKLDIDIIRVHKI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatattataggaattggaacaaatagtggttttactatcgaaaatattcatctt
gcaataactgcactagaatcgcaacaaaatataagaatcatcagaaaagcaagcttatac
agtagtaaagctgtccttaaagaagacgctcctaaagaatgggatattagatttttaaat
acagctgtaaaaattagttcttcactaaagcctgatgaacttttagtactcttaaaagac
atagaattaaaaataggtagagacctaaatgctcctgcatggtcacctcgagtaattgat
ttagatattcttgctgctgaagatctaattttagaaacagacaaacttactattcctcat
aaagaactaattaatcgtagttttgcgttggctcctttattagaattatcaaagggttgg
catcaccctaaatatgttgaatgggatcttaatataagattaaaagaattaggtgagata
gtaaaacttaaacaaactcttgcaaatacacgtatgggtatagttaatctgtcaaatcaa
tctttttcagatggtaattttgatgataatcaacgtaaattaaaccttgatgagctaata
caaagtggtgctgaaattattgatatcggagctgaatcgactaagcctgatgccaagcct
atatcgattgaagaagaatttaacaaattagatgaattcctagaatactttaaatcacaa
ctggcaaatttgatttataaaccattagtcagtattgacacacgcaaactagaggtaatg
caaaaaattctcgctaagcatcatgatattatctggatgataaatgatgttgaatgtaat
aatattgagcaaaaagcacagcttatagctaaatataataaaaagtatgttataattcat
aatttgggtattacagatagaaatcaatatttagataaagaaaatgctatagataatgtt
tgtgattatattgagcaaaaaaagcaaattctgctaaaacatggtatagcacaacaaaat
atttattttgatattggctttggttttggtaaaaaatcagataccgctagatacttatta
gagaatatcatcgagataaaaagaagattagaattaaaagcattagttggtcactcacgt
aagccatcagttttaggattagcaaaagatagtaatttagcaactttagatcgagctaca
agagagctttcaagaaaattagagaaactagatattgatattataagagtacacaagatt
taa

DBGET integrated database retrieval system