KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1024Help
Entry
FTM_1024          CDS       T00698                                 

Gene name
recR
Definition
(GenBank) RecFOR complex, RecR component
  KO
K06187  recombination protein RecR
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTM_1024 (recR)
DNA repair and recombination proteins [BR:ftm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     FTM_1024 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FTM_1024 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ACD30938
UniProt: B2SGT0
Position
1105188..1105790
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLNILQQIIADRKIDEVILAISPTVEGETTAHFISQMIVKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagataaatcacct
gaaacagcaatagctattgccaactcacttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcata
ggtccaagtgaattaaagctaaatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgtcaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttagatcaacaaactttactacatgcttttaatgcaagaactaatatt
taa

DBGET integrated database retrieval system