KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1377Help
Entry
FTM_1377          CDS       T00698                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00010  Glycolysis / Gluconeogenesis
ftm00052  Galactose metabolism
ftm00500  Starch and sucrose metabolism
ftm00520  Amino sugar and nucleotide sugar metabolism
ftm00521  Streptomycin biosynthesis
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01120  Microbial metabolism in diverse environments
ftm01130  Biosynthesis of antibiotics
ftm01200  Carbon metabolism
Module
ftm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTM_1377
   00052 Galactose metabolism
    FTM_1377
   00500 Starch and sucrose metabolism
    FTM_1377
   00520 Amino sugar and nucleotide sugar metabolism
    FTM_1377
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTM_1377
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTM_1377
Enzymes [BR:ftm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTM_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACD31214
Position
complement(1482224..1483189)
Genome map
AA seq 321 aa AA seqDB search
MYIGLDIGGSNISAGIFDEQKNLIKTAKVKSKGKSDADVILAQIFKVINKLLDSSNKNKI
KAIGIGIAGFVDSKSGVLNFSANINLNGINIAQEVSQKFANVPVFIENDVNVGVIGEWKY
GAGRSHQNIVGIFAGTGIGGGLVVNNQFLYGVTGGAGAVGHVTINSQGAYCQSCGSQGCL
ETYAGKVGIENRLMNLHKKGIKSILIDFVLENKGKLKGSHLKKALAAKDKIAEDIMTNAM
SNLGIAVANYINLLNPSMVLFGGGIIEAVGQQYLDTIYQSYSKYAFKTMLDACELKIATL
GDNSGVYGAMDIAVNRLEGNW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtacataggtttagatattggcggtagtaatatctctgctggtatttttgatgagcaa
aagaaccttattaaaactgcaaaggttaaatcaaaaggcaaaagtgatgctgatgtaatt
ctagcgcagattttcaaagtgattaataaactacttgatagttcaaataaaaataagata
aaagctataggtattggcattgctggttttgttgattcaaaatcaggtgtcttaaatttc
agtgctaatatcaaccttaatggtataaatattgctcaagaagtcagccaaaaatttgca
aatgtaccagtatttatcgaaaatgatgtaaatgtgggtgttattggtgaatggaaatat
ggtgctggtagaagccatcaaaatattgttggtatatttgcaggcactggtattggtggc
ggtcttgtggtaaataatcagtttttgtatggagttacaggaggtgcaggcgcagttggg
catgtgactattaatagtcaaggagcttattgtcagagctgtggatcacaaggatgttta
gaaacttatgctggtaaagttggtattgaaaatagacttatgaatttgcataaaaaaggt
ataaaaagcatcctgatagattttgttttagaaaataaaggtaaactcaagggttctcat
cttaaaaaagctttagcagccaaagataaaatagctgaagatataatgaccaatgcaatg
tctaatctaggaattgctgtggcaaactatatcaatcttttaaacccgtcaatggtattg
ttcggtggtgggattattgaggcagttggacagcagtacttagatactatttatcagtca
tattcaaaatatgctttcaaaacgatgttagatgcttgtgagttgaaaatcgcaacatta
ggcgataattcaggtgtgtatggtgctatggatatagcagttaatcggttagagggaaat
tggtaa

DBGET integrated database retrieval system