KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1377Help
Entry
FTM_1377          CDS       T00698                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTM_1377
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTM_1377
   00052 Galactose metabolism
    FTM_1377
   00500 Starch and sucrose metabolism
    FTM_1377
   00520 Amino sugar and nucleotide sugar metabolism
    FTM_1377
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTM_1377
   00524 Butirosin and neomycin biosynthesis
    FTM_1377
Enzymes [BR:ftm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTM_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1482224..1483189)
Genome map
AA seq 321 aa AA seqDB search
MYIGLDIGGSNISAGIFDEQKNLIKTAKVKSKGKSDADVILAQIFKVINKLLDSSNKNKI
KAIGIGIAGFVDSKSGVLNFSANINLNGINIAQEVSQKFANVPVFIENDVNVGVIGEWKY
GAGRSHQNIVGIFAGTGIGGGLVVNNQFLYGVTGGAGAVGHVTINSQGAYCQSCGSQGCL
ETYAGKVGIENRLMNLHKKGIKSILIDFVLENKGKLKGSHLKKALAAKDKIAEDIMTNAM
SNLGIAVANYINLLNPSMVLFGGGIIEAVGQQYLDTIYQSYSKYAFKTMLDACELKIATL
GDNSGVYGAMDIAVNRLEGNW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtacataggtttagatattggcggtagtaatatctctgctggtatttttgatgagcaa
aagaaccttattaaaactgcaaaggttaaatcaaaaggcaaaagtgatgctgatgtaatt
ctagcgcagattttcaaagtgattaataaactacttgatagttcaaataaaaataagata
aaagctataggtattggcattgctggttttgttgattcaaaatcaggtgtcttaaatttc
agtgctaatatcaaccttaatggtataaatattgctcaagaagtcagccaaaaatttgca
aatgtaccagtatttatcgaaaatgatgtaaatgtgggtgttattggtgaatggaaatat
ggtgctggtagaagccatcaaaatattgttggtatatttgcaggcactggtattggtggc
ggtcttgtggtaaataatcagtttttgtatggagttacaggaggtgcaggcgcagttggg
catgtgactattaatagtcaaggagcttattgtcagagctgtggatcacaaggatgttta
gaaacttatgctggtaaagttggtattgaaaatagacttatgaatttgcataaaaaaggt
ataaaaagcatcctgatagattttgttttagaaaataaaggtaaactcaagggttctcat
cttaaaaaagctttagcagccaaagataaaatagctgaagatataatgaccaatgcaatg
tctaatctaggaattgctgtggcaaactatatcaatcttttaaacccgtcaatggtattg
ttcggtggtgggattattgaggcagttggacagcagtacttagatactatttatcagtca
tattcaaaatatgctttcaaaacgatgttagatgcttgtgagttgaaaatcgcaacatta
ggcgataattcaggtgtgtatggtgctatggatatagcagttaatcggttagagggaaat
tggtaa

DBGET integrated database retrieval system