KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1391Help
Entry
FTM_1391          CDS       T00698                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ftm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1495235..1496059
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVKRGLIKTIIDKKIFDIEINTDKLRYPIDKDQLVKIKNKVVKEIQRRGKHL
IIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLSDNLSLVYNDPRKFGYWLVN
TNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEA
LFDSNILPTRASNTITKKEAANLISSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLN
VYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttcctgaagtagaaacagtaaaaagaggcttaattaaaactattatcgat
aaaaagatatttgatattgagattaataccgataagcttcgctaccctattgataaagac
caattagtaaaaattaaaaataaagtagtcaaagaaatacaacgcagaggtaagcattta
ataattttcattgaagatgatttacaattaattattcacttaggcatgtctggaattatt
aaagttatagactcgacaaactacaataaaatcaaacatgatcacatcgttgtaacgcta
tcagataatctatctttagtttacaatgatccacgtaaatttggttattggttagtaaat
actaatcacacacctcttgagcatagagttttagtatcacatggtgttgaaccactaaca
gctgattttaatagtgactatctagtttctaaacttaagcaaacatcaagaaaaatcaaa
caaacgattatggataataatattgtcgttggtgtgggtaatatatatgctagtgaggcg
ctatttgatagtaatatcctaccaacaagagcttctaatactattaccaaaaaagaagca
gctaacctaatatcatctataaaaaaaatactggaaaaagctattacacaaggtggaacc
actcttaaagattataaaaacaccgagggtaaacccggttattttactcaacaactaaat
gtctatggtagaaatgaacaacaatgttatgtatgtaatacaaaaatacaaagtctagtt
atagctcaaagaaatacttttttttgtaaaaagtgtcagaaataa

DBGET integrated database retrieval system