KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1400Help
Entry
FTM_1400          CDS       T00698                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00020  Citrate cycle (TCA cycle)
ftm00640  Propanoate metabolism
ftm00660  C5-Branched dibasic acid metabolism
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01120  Microbial metabolism in diverse environments
ftm01130  Biosynthesis of antibiotics
ftm01200  Carbon metabolism
Module
ftm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTM_1400 (sucC)
   00640 Propanoate metabolism
    FTM_1400 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FTM_1400 (sucC)
Enzymes [BR:ftm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FTM_1400 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACD31235
UniProt: B2SDM1
Position
1506680..1507843
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAARAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAVLINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILADSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcgagcatttgaccaattaggtggc
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaggttgttaaatcatctcaagaagctcgtgaagtagcagaaagcttaatcggtaaaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtgtatttgaa
gatgtataccctgttactcgtgagttataccttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggcggtgtagatattgaagaagttgcacacaac
tctcctgaaaaaattcttaaagtagaagtagatcctttagttggcttacaacctttccaa
gctcgtgaagtagctttcaagcttggtctagaaggcaagcaaatcaatgattttgttaaa
actatgctaggcgcttacaaagcattcatcgaatgtgattttgccctatttgaaatcaac
cctcttgcagttagagaaaacggagagattgtctgtgttgatggtaaaatcaaccttgat
tcaaatgctctttatagacaccctaaacttttagctctaagagacaaatctcaagaaaat
gctaaagaacttaaagcttcagagcatgagctaaactatgtagctcttgaaggtaacatc
ggttgtatggtaaacggtgctggtctagcaatggctactatggatattatccaattatac
ggtggtaagcctgctaacttcctagatgtaggtggtggtgctactaaagagagagtaatc
gaagctttcaaactaatcctagatgatgaaaatgtaaaagctgttttaattaacatcttc
ggtggtattgttcgttgtgatatgatcgctgaagcaattattgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaaa
atattagctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtgaaatcactaggttaa

DBGET integrated database retrieval system