KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1553Help
Entry
FTM_1553          CDS       T00698                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ftm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ftm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ftm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ftm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ftm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1663943..1664383)
Genome map
AA seq 146 aa AA seqDB search
MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFI
PHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQD
SALQASRKKYVYYKKSNLEIITVQDN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtg
ctgattactgaagttgtcaaagaatatgctttacaaaagacaattgcaatcttagcacca
gcaggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatc
ccacatcattgtgctataaatgctagagagtataatcaatataataatattccaattctt
atcacagataatctatttattacctcaggttatgatgttttaataaatattatggatgtg
gctgtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagat
agcgctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagata
attactgttcaagataactaa

DBGET integrated database retrieval system