KEGG   Francisella tularensis subsp. novicida U112: FTN_0019Help
Entry
FTN_0019          CDS       T00432                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00240  Pyrimidine metabolism
ftn00250  Alanine, aspartate and glutamate metabolism
ftn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FTN_0019 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTN_0019 (pyrB)
Enzymes [BR:ftn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     FTN_0019 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace HSBP1
Motif
Other DBs
NCBI-ProteinID: ABK88930
UniProt: A0Q3W5
Position
complement(17049..17975)
Genome map
AA seq 308 aa AA seqDB search
MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYSEKATLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMALL
SLLLKSQN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattactaaagatgacttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgagtcggctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggtgaaacccttgatgatacaggtagaatgattgatcaatatgct
gatattatcgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggagatggtgaaaatgaacaccctacccaatctcttgta
gatttatatactatctactctgagaaagccacccttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataac
gcctcgtttaaatttatatcttcaaaagagctacagattcctaaaaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtgccgatgttttagaa
gacttagatgtactatatgtaactcgcgtccagagagaaaggtttcctgatgaagaaagt
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattccgattaggatggcgctatta
tcattacttctaaagtcacaaaactaa

DBGET integrated database retrieval system