KEGG   Francisella tularensis subsp. novicida U112: FTN_0462Help
Entry
FTN_0462          CDS       T00432                                 

Gene name
glk
Definition
(GenBank) glucose kinase (glucokinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00010  Glycolysis / Gluconeogenesis
ftn00052  Galactose metabolism
ftn00500  Starch and sucrose metabolism
ftn00520  Amino sugar and nucleotide sugar metabolism
ftn00521  Streptomycin biosynthesis
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn01130  Biosynthesis of antibiotics
ftn01200  Carbon metabolism
Module
ftn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTN_0462 (glk)
   00052 Galactose metabolism
    FTN_0462 (glk)
   00500 Starch and sucrose metabolism
    FTN_0462 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    FTN_0462 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTN_0462 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTN_0462 (glk)
Enzymes [BR:ftn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTN_0462 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF3310 ROK Statherin
Motif
Other DBs
NCBI-ProteinID: ABK89365
UniProt: A0Q550
Position
468195..469211
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatatcattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtctcgcagtagctggatttgtctctaatggtgaagttgaagtaactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaagaaggtaaaaaggatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgatgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcgttatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagagccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacatgatgaaggattttccagtgcatataattatg
aacacagatgtcggtttaataggcgcgcgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system