KEGG   Francisella tularensis subsp. novicida: FTN_0518Help
Entry
FTN_0518          CDS       T00432                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FTN_0518 (malQ)
Enzymes [BR:ftn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FTN_0518 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536994..538457
Genome map
AA seq 487 aa AA seqDB search
MTKAGLLLAISSLPSRFGIGDLGKSAYEFVDILKQAGTRIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFKDNYLEEAFNNFQSSKD
KFGQEYNDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKNWVKEKAIELDQFQREID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEIFLLDENQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWVEAPGYEFFDTVYKRIPDANIIAEDLGDLRLEVFELRDHYNLKGMKV
FPFHFDLKTGSFIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLNCEAEYVILPVQDVLELDGTARLNTPGTVGSPNWQWKLADFNLLKSKTNRLAKQ
VSKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagctggattattattagctatttcaagtttacctagccggtttggcattggt
gatctgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctggtactagaatt
tggcaggttttaccccttacaccactaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgcaaactctaaaaaagttgaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcctttaacaattttcaaagctcaaaagat
aagttcggacaagagtataatgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggaatttctggcctgcagaa
tataaaaactgggttaaagagaaagctatagaacttgatcaatttcaacgagagatagat
tatcaaatatttttacagtttatattttataagcagtggtttgagctaagagagtatgct
aataaaaataatattgaaattatgggtgatttgcctatttatctaggttttgattctgct
gatgtatgggagcatcaagaaatatttttattagatgagaatcaaaatcctagttttgtt
gcaggagttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataagctcaaagaaacaaattttgatttttggatagatcggctaaatggtaat
ttcaagctatttgatattgttaggattgaccattttagagcttttgatacttactggaaa
atacctgctggtgaaaaaactgctataaatggcgagtgggttgaggctcctggatatgag
ttttttgatacagtatataaacgtattccagatgctaatattattgcggaagatttagga
gatttacgcctagaggtatttgagttgagagaccactataaccttaaaggtatgaaggtt
ttcccgtttcattttgatctaaaaactggtagttttattgatgatgctaatatcatagct
tattcaggtactcatgataataacactttgaaaggttggtattttgatgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttaactgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtacagtaggctcgccaaattgg
caatggaagttggctgattttaatttacttaagtcaaaaactaatcgcttagctaaacag
gtatctaagtctataaatcattaa

DBGET integrated database retrieval system