KEGG   Francisella tularensis subsp. novicida U112: FTN_0527Help
Entry
FTN_0527          CDS       T00432                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTN_0527 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTN_0527 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTN_0527 (thrC)
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTN_0527 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548701..549990
Genome map
AA seq 429 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVPERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVKRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLATGKFNPKASVETLANAMD
VGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQAYRQYHEVVCPHTATGFVAK
NRLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDELCE
VYTKAFERE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcccagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaaaaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagagaactaagttaaatacatcaaatagtattaatatcggtagattattaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagcgactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctagtaattttgaaagattgttatatttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gcgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcggttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
ctactagacaaagagcaaaataaagtagtgataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaaagagaataa

DBGET integrated database retrieval system